Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lum Peptide - N-terminal region

Lum Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ldc, SLRR2D

UniProt

P51885

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lum Rabbit Polyclonal Antibody (orb582439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_032550

Preservative

Lyophilized powder

AA Sequence

KSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromo Pfu DNA Polymerase (1U/µl), 100U
PL5205 100 U

Chromo Pfu DNA Polymerase (1U/µl), 100U

Sign In for Pricing
View Details
Streptavidin High Binding Coated - 96 well Solid plates - White PS
MCWSTDF-SB75/100/W 10x 96 Well Plates

Streptavidin High Binding Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
ROR alpha / RORA Recombinant Rabbit monoclonal Antibody
HA723267 100 µL

ROR alpha / RORA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), CF594 conjugate, 0.1mg/mL
BNC940173-500 1x 500 µL

CD45 / LCA (136-4B5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuantiQuik™ Urea (BUN) Quick Test Strips
QQUREA10 10 Tests

QuantiQuik™ Urea (BUN) Quick Test Strips

Sign In for Pricing
View Details
RASSF6 Antibody
8C18183-AAT 50 µg

RASSF6 Antibody

Sign In for Pricing
View Details