Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY96 Peptide - C-terminal region

LY96 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MD-2, MD2, ly-96, ESOP-1

UniProt

Q9Y6Y9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LY96 Rabbit Polyclonal Antibody (orb584935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056179

Preservative

Lyophilized powder

AA Sequence

NLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61370R-BF405-TR 20 µL

RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Monkey Neurotrophin-3 (Neurotrphic Factor) High-Sensitivity ELISA Kit
IMNNTF3KTH 1 Each

Monkey Neurotrophin-3 (Neurotrphic Factor) High-Sensitivity ELISA Kit

Sign In for Pricing
View Details
WLS Protein Vector (Rat) (pPM-C-His)
PV316613 500 ng

WLS Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Glutathione Peroxidase 3, ID (GPX3, GSHPx-3, GPx-3, GSHPx-P, GPx-P, GPXP) (MaxLight 490) discontinued
036272-ML490 100 µL

Glutathione Peroxidase 3, ID (GPX3, GSHPx-3, GPx-3, GSHPx-P, GPx-P, GPXP) (MaxLight 490) discontinued

Sign In for Pricing
View Details
(4-Methoxy-3-nitrophenyl) methanesulfonyl fluoride
BAC92442-01 50 mg

(4-Methoxy-3-nitrophenyl) methanesulfonyl fluoride

Sign In for Pricing
View Details
(4-Methoxy-3-nitrophenyl) methanesulfonyl fluoride
BAC92442-02 0.5 g

(4-Methoxy-3-nitrophenyl) methanesulfonyl fluoride

Sign In for Pricing
View Details