Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyar Peptide - N-terminal region

Lyar Peptide - N-terminal region

Product Specifications

Product Name Alternative

MLZ-264

UniProt

Q08288

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lyar Rabbit Polyclonal Antibody (orb583423) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079557

Preservative

Lyophilized powder

AA Sequence

INELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSLKVHSDSVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF405S conjugate, 0.1mg/mL
BNC041631-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SV2A Antibody
KC-392-01 50 μL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-392-02 100 µL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-392-03 1 mL

SV2A Antibody

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF740 conjugate, 0.1mg/mL
BNC741482-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYL9 Recombinant Rabbit monoclonal Antibody
HA750777 100 µL

MYL9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details