LYG2 Peptide - middle region
LYG2 Peptide - middle region
Product Specifications
Product Name Alternative
LYGH, MGC119046, MGC119047, MGC119049
UniProt
Q86SG7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LYG2 Rabbit Polyclonal Antibody (orb326383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_783862
Preservative
Lyophilized powder
AA Sequence
AAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQA
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1089910-01 0.02 mg (E-Coli)
Recombinant Volvox carteri Histone H2A-IV
Sign In for Pricing
View Details MBS1089910-02 0.1 mg (E-Coli)
Recombinant Volvox carteri Histone H2A-IV
Sign In for Pricing
View Details MBS1089910-03 0.02 mg (Yeast)
Recombinant Volvox carteri Histone H2A-IV
Sign In for Pricing
View Details MBS1089910-04 0.1 mg (Yeast)
Recombinant Volvox carteri Histone H2A-IV
Sign In for Pricing
View Details MBS1089910-05 0.02 mg (Baculovirus)
Recombinant Volvox carteri Histone H2A-IV
Sign In for Pricing
View Details MBS1089910-06 0.02 mg (Mammalian-Cell)
Recombinant Volvox carteri Histone H2A-IV
Sign In for Pricing
View Details