Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYG2 Peptide - middle region

LYG2 Peptide - middle region

Product Specifications

Product Name Alternative

LYGH, MGC119046, MGC119047, MGC119049

UniProt

Q86SG7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYG2 Rabbit Polyclonal Antibody (orb326383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783862

Preservative

Lyophilized powder

AA Sequence

AAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Iodo-2,3-dimethoxybenzene-d6
409873 10 mg

1-Iodo-2,3-dimethoxybenzene-d6

Sign In for Pricing
View Details
Human Heat shock-related 70 kDa protein 2 ELISA Kit
EK5081 Inquire

Human Heat shock-related 70 kDa protein 2 ELISA Kit

Sign In for Pricing
View Details
Pimeloyl chloride 98%
P19460 5 g

Pimeloyl chloride 98%

Sign In for Pricing
View Details
NEURL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV624025 1.0 µg DNA

NEURL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
E. coli Formamidopyrimidine-DNA Glycosylase (MUTM) Protein
abx073795-01 2 µg

E. coli Formamidopyrimidine-DNA Glycosylase (MUTM) Protein

Sign In for Pricing
View Details
E. coli Formamidopyrimidine-DNA Glycosylase (MUTM) Protein
abx073795-02 10 µg

E. coli Formamidopyrimidine-DNA Glycosylase (MUTM) Protein

Sign In for Pricing
View Details