Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lynx1 Peptide - middle region

Lynx1 Peptide - middle region

Product Specifications

Product Name Alternative

AI838844

UniProt

Q9WVC2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lynx1 Rabbit Polyclonal Antibody (orb584089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035968

Preservative

Lyophilized powder

AA Sequence

PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GnT-III Antibody
CQA1732-01 30 µL

Anti-GnT-III Antibody

Sign In for Pricing
View Details
Anti-GnT-III Antibody
CQA1732-02 50 μL

Anti-GnT-III Antibody

Sign In for Pricing
View Details
Anti-GnT-III Antibody
CQA1732-03 100 µL

Anti-GnT-III Antibody

Sign In for Pricing
View Details
Anti-GnT-III Antibody
CQA1732-04 200 µL

Anti-GnT-III Antibody

Sign In for Pricing
View Details
RN5S265 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV744373 1.0 µg DNA

RN5S265 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
DFNA45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0588405 3x 1.0 µg

DFNA45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details