Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lynx1 Peptide - middle region

Lynx1 Peptide - middle region

Product Specifications

Product Name Alternative

AI838844

UniProt

Q9WVC2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lynx1 Rabbit Polyclonal Antibody (orb584089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035968

Preservative

Lyophilized powder

AA Sequence

PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN6, ID (CAPN6, CALPM, CANPX, Calpain-6, Calpain-like protease X-linked, Calpamodulin) (AP) discontinued
033183-AP 200 µL

CAPN6, ID (CAPN6, CALPM, CANPX, Calpain-6, Calpain-like protease X-linked, Calpamodulin) (AP) discontinued

Sign In for Pricing
View Details
E2F6 (NM_198256) Human Tagged Lenti ORF Clone
RC210680L3 10 µg

E2F6 (NM_198256) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CLEC1B Antibody
orb1561837-01 50 µL

CLEC1B Antibody

Sign In for Pricing
View Details
CLEC1B Antibody
orb1561837-02 100 µL

CLEC1B Antibody

Sign In for Pricing
View Details
CLEC1B Antibody
orb1561837-03 200 µL

CLEC1B Antibody

Sign In for Pricing
View Details
Recombinant ADH4 Antibody
RC-16535-01 50 μL

Recombinant ADH4 Antibody

Sign In for Pricing
View Details