Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYZ Peptide - C-terminal region

LYZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZM, lysozyme

UniProt

P61626

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYZ Rabbit Polyclonal Antibody (orb584634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000230

Preservative

Lyophilized powder

AA Sequence

HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)
AP75565-01 10 µg

Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)
AP75565-02 50 µg

Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)
AP75565-03 500 µg

Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)
AP75565-04 1 mg

Recombinant Human Pregnancy-Specific β-1-Glycoprotein 1/PSG1 (C-6His)

Sign In for Pricing
View Details
Hexacosanoic acid
BUP14795 1 Each

Hexacosanoic acid

Sign In for Pricing
View Details
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone
RG219138 10 µg

Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone

Sign In for Pricing
View Details