Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYZ Peptide - C-terminal region

LYZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZM, lysozyme

UniProt

P61626

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYZ Rabbit Polyclonal Antibody (orb584634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000230

Preservative

Lyophilized powder

AA Sequence

HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRBP1 siRNA (Mouse)
CRN0137-01 15 nmol

RRBP1 siRNA (Mouse)

Sign In for Pricing
View Details
RRBP1 siRNA (Mouse)
CRN0137-02 30 nmol

RRBP1 siRNA (Mouse)

Sign In for Pricing
View Details
FKRP, CT (FKRP, Fukutin-related protein) (MaxLight 490)
MBS6199246-01 0.1 mL

FKRP, CT (FKRP, Fukutin-related protein) (MaxLight 490)

Sign In for Pricing
View Details
FKRP, CT (FKRP, Fukutin-related protein) (MaxLight 490)
MBS6199246-02 5x 0.1 mL

FKRP, CT (FKRP, Fukutin-related protein) (MaxLight 490)

Sign In for Pricing
View Details
MME, ID (MME, EPN, Neprilysin, Atriopeptidase, Common acute lymphocytic leukemia antigen, Enkephalinase, Neutral endopeptidase 24.11, Skin fibroblast elastase, CD10) (MaxLight 750)
MBS6321282-01 0.1 mL

MME, ID (MME, EPN, Neprilysin, Atriopeptidase, Common acute lymphocytic leukemia antigen, Enkephalinase, Neutral endopeptidase 24.11, Skin fibroblast elastase, CD10) (MaxLight 750)

Sign In for Pricing
View Details
MME, ID (MME, EPN, Neprilysin, Atriopeptidase, Common acute lymphocytic leukemia antigen, Enkephalinase, Neutral endopeptidase 24.11, Skin fibroblast elastase, CD10) (MaxLight 750)
MBS6321282-02 5x 0.1 mL

MME, ID (MME, EPN, Neprilysin, Atriopeptidase, Common acute lymphocytic leukemia antigen, Enkephalinase, Neutral endopeptidase 24.11, Skin fibroblast elastase, CD10) (MaxLight 750)

Sign In for Pricing
View Details