Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYZ Peptide - N-terminal region

LYZ Peptide - N-terminal region

Product Specifications

Product Name Alternative

LZM, lysozyme

UniProt

P61626

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYZ Rabbit Polyclonal Antibody (orb584635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000230

Preservative

Lyophilized powder

AA Sequence

CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Pulegone
TRC-P840170-5ML 5 mL

(S)-Pulegone

Sign In for Pricing
View Details
CPM
#91010 1x 25 mg

CPM

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561984 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS706494 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
SFTPD/SP-D Polyclonal Antibody
D-AB-10441L-01 25 µL

SFTPD/SP-D Polyclonal Antibody

Sign In for Pricing
View Details
SFTPD/SP-D Polyclonal Antibody
D-AB-10441L-02 100 µL

SFTPD/SP-D Polyclonal Antibody

Sign In for Pricing
View Details