Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYZL4 Peptide - middle region

LYZL4 Peptide - middle region

Product Specifications

Product Name Alternative

1810009N24Rik, LYC4, MGC26768

UniProt

Q96KX0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYZL4 Rabbit Polyclonal Antibody (orb55718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653235

Preservative

Lyophilized powder

AA Sequence

FNPMAIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA2 Antibody
E036640 100 µg -100 µL

NDUFA2 Antibody

Sign In for Pricing
View Details
O2 Depletion monitor-UK plug - EACH
GAS1302 1 Each

O2 Depletion monitor-UK plug - EACH

Sign In for Pricing
View Details
SAPS2 Recombinant Protein Antigen
NBP1-88014PEP 0.1 mL

SAPS2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit Monoclonal OCT2 Antibody (OCT2/7073R) [HRP]
NBP3-14146H 0.1 mL

Rabbit Monoclonal OCT2 Antibody (OCT2/7073R) [HRP]

Sign In for Pricing
View Details
Unc93a Mouse siRNA Oligo Duplex (Locus ID 381058)
SR414901 1 Kit

Unc93a Mouse siRNA Oligo Duplex (Locus ID 381058)

Sign In for Pricing
View Details
Mouse Ptk7 protein
orb54198-01 20 µg

Mouse Ptk7 protein

Sign In for Pricing
View Details