Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYZL4 Peptide - middle region

LYZL4 Peptide - middle region

Product Specifications

Product Name Alternative

1810009N24Rik, LYC4, MGC26768

UniProt

Q96KX0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYZL4 Rabbit Polyclonal Antibody (orb55718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653235

Preservative

Lyophilized powder

AA Sequence

FNPMAIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Ankyrin repeat and SOCS box protein 6 (ASB6) ELISA kit
GTR10375241 96 Well

Chicken Ankyrin repeat and SOCS box protein 6 (ASB6) ELISA kit

Sign In for Pricing
View Details
Monkey gamma-Glutamyl Transpeptidase ELISA Kit
MBS7262804-01 48 Well

Monkey gamma-Glutamyl Transpeptidase ELISA Kit

Sign In for Pricing
View Details
Monkey gamma-Glutamyl Transpeptidase ELISA Kit
MBS7262804-02 96 Well

Monkey gamma-Glutamyl Transpeptidase ELISA Kit

Sign In for Pricing
View Details
Monkey gamma-Glutamyl Transpeptidase ELISA Kit
MBS7262804-03 5x 96 Well

Monkey gamma-Glutamyl Transpeptidase ELISA Kit

Sign In for Pricing
View Details
Monkey gamma-Glutamyl Transpeptidase ELISA Kit
MBS7262804-04 10x 96 Well

Monkey gamma-Glutamyl Transpeptidase ELISA Kit

Sign In for Pricing
View Details
NKAPL, CT (NKAPL, C6orf194, NKAP-like protein) (MaxLight 550) discontinued
038986-ML550 100 µL

NKAPL, CT (NKAPL, C6orf194, NKAP-like protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details