Maf1 Peptide - N-terminal region
Maf1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
1110068E11Rik, AU042856
UniProt
Q9D0U6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Maf1 Rabbit Polyclonal Antibody (orb581189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001158079
Preservative
Lyophilized powder
AA Sequence
HVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940853-500 1x 500 µL
P34 / cdk1 (POH-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PE/Elab Fluor® 594 Anti-Mouse IFN-γ Antibody[XMG1.2]](https://cdn.genprice.uk/products/763/68dd1499061270361e7ce95f/imageurl/e-ab-f1101up.webp)
E-AB-F1101UP-01 25 µg
PE/Elab Fluor® 594 Anti-Mouse IFN-γ Antibody[XMG1.2]
Sign In for Pricing
View Details E-AB-F1101UP-02 100 µg
PE/Elab Fluor® 594 Anti-Mouse IFN-γ Antibody[XMG1.2]
Sign In for Pricing
View Details 
22836-AAT 100 Tests
Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Green Fluorescence Excited at 405 nm*
Sign In for Pricing
View Details 