Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Maf1 Peptide - N-terminal region

Maf1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110068E11Rik, AU042856

UniProt

Q9D0U6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Maf1 Rabbit Polyclonal Antibody (orb581189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158079

Preservative

Lyophilized powder

AA Sequence

HVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCP3 (SYCP3) Mouse Monoclonal Antibody [Clone ID: OTI1B11]
CF806613 100 µg

SCP3 (SYCP3) Mouse Monoclonal Antibody [Clone ID: OTI1B11]

Sign In for Pricing
View Details
TentaGel® S PHB
S30013.25G 25 g

TentaGel® S PHB

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), 1mg/mL
BNUM1780-50 1x 50 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), 1mg/mL

Sign In for Pricing
View Details
Z-Guggulsterone
SIH-591-5MG 5 mg

Z-Guggulsterone

Sign In for Pricing
View Details
TCP11L2 Polyclonal Antibody
E-AB-90624-01 60 µL

TCP11L2 Polyclonal Antibody

Sign In for Pricing
View Details
TCP11L2 Polyclonal Antibody
E-AB-90624-02 120 µL

TCP11L2 Polyclonal Antibody

Sign In for Pricing
View Details