Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafk Peptide - N-terminal region

Mafk Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW061068, NF-E2, Nfe2u

UniProt

Q61827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mafk Rabbit Polyclonal Antibody (orb580107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034887

Preservative

Lyophilized powder

AA Sequence

TTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FAS/CD95 Antibody Pair Set
E-KAB-0691 50 µL & 100 µg

Mouse FAS/CD95 Antibody Pair Set

Sign In for Pricing
View Details
C16orf87 Antibody
KC-44491-01 50 μL

C16orf87 Antibody

Sign In for Pricing
View Details
C16orf87 Antibody
KC-44491-02 100 µL

C16orf87 Antibody

Sign In for Pricing
View Details
C16orf87 Antibody
KC-44491-03 1 mL

C16orf87 Antibody

Sign In for Pricing
View Details
EVI5 (NM_005665) Human Over-expression Lysate
LY401728 100 µg

EVI5 (NM_005665) Human Over-expression Lysate

Sign In for Pricing
View Details
UBA52 Mouse Monoclonal Antibody [Clone ID: OTI1C6]
CF805019 100 µg

UBA52 Mouse Monoclonal Antibody [Clone ID: OTI1C6]

Sign In for Pricing
View Details