Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafk Peptide - N-terminal region

Mafk Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW061068, NF-E2, Nfe2u

UniProt

Q61827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mafk Rabbit Polyclonal Antibody (orb580107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034887

Preservative

Lyophilized powder

AA Sequence

TTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vgl4 (VGLL4) Human Gene Knockout Kit (CRISPR)
KN400886 1 Kit

Vgl4 (VGLL4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF647 conjugate, 0.1mg/mL
BNC470726-100 1x 100 µL

DOG-1 (DG1/447 + DOG1.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CSTA (Cystatin A) CLIA Kit
E-CL-H0139-01 24 Tests

Human CSTA (Cystatin A) CLIA Kit

Sign In for Pricing
View Details
Human CSTA (Cystatin A) CLIA Kit
E-CL-H0139-02 48 Tests

Human CSTA (Cystatin A) CLIA Kit

Sign In for Pricing
View Details
Human CSTA (Cystatin A) CLIA Kit
E-CL-H0139-03 96 Tests

Human CSTA (Cystatin A) CLIA Kit

Sign In for Pricing
View Details
Human KLHL38 activation kit by CRISPRa
GA117474 1 Kit

Human KLHL38 activation kit by CRISPRa

Sign In for Pricing
View Details