Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA11 Peptide - middle region

MAGEA11 Peptide - middle region

Product Specifications

Product Name Alternative

CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511

UniProt

P43364

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA11 Rabbit Polyclonal Antibody (orb584493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005357

Preservative

Lyophilized powder

AA Sequence

FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF83 Polyclonal Conjugated Antibody
C31829 100 µL

ZNF83 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
BRD1 Antibody - N-terminal region
OAAB10316-400UL 400 µL

BRD1 Antibody - N-terminal region

Sign In for Pricing
View Details
ATF2 (Ab-62/44)
ANTY021029 100ug

ATF2 (Ab-62/44)

Sign In for Pricing
View Details
Grancalcin (GCA) (NM_012198) Human Over-expression Lysate
LH08717V 100 µg

Grancalcin (GCA) (NM_012198) Human Over-expression Lysate

Sign In for Pricing
View Details
CSN3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
16937151 3x 1.0 µg DNA

CSN3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
KIF14 CRISPR Activation Plasmid (m2)
sc-436262-ACT-2 20 µg

KIF14 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details