Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA11 Peptide - middle region

MAGEA11 Peptide - middle region

Product Specifications

Product Name Alternative

CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511

UniProt

P43364

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA11 Rabbit Polyclonal Antibody (orb584493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005357

Preservative

Lyophilized powder

AA Sequence

FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-17F ELISPOT kit
CT418-PR2 2 Plates

Human IL-17F ELISPOT kit

Sign In for Pricing
View Details
TCEAL4 Protein Vector (Human) (pPB-C-His)
PV041497 500 ng

TCEAL4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-NKG2D/KLRK1 Antibody Picoband® Fluoro594 Conjugated
A00661-1-Fluoro594 100 µg/Vial

Anti-NKG2D/KLRK1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Porcine Activin A Receptor Type II A ELISA Kit
MBS084380-01 48 Well

Porcine Activin A Receptor Type II A ELISA Kit

Sign In for Pricing
View Details
Porcine Activin A Receptor Type II A ELISA Kit
MBS084380-02 96 Well

Porcine Activin A Receptor Type II A ELISA Kit

Sign In for Pricing
View Details
Porcine Activin A Receptor Type II A ELISA Kit
MBS084380-03 5x 96 Well

Porcine Activin A Receptor Type II A ELISA Kit

Sign In for Pricing
View Details