Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA5 Peptide - N-terminal region

MAGEA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAGE5, MAGEA4, MGC129526, CT1.5

UniProt

P43359

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA5 Rabbit Polyclonal Antibody (orb579740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066387

Preservative

Lyophilized powder

AA Sequence

MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARS Antibody
KC-17097-01 50 μL

DARS Antibody

Sign In for Pricing
View Details
DARS Antibody
KC-17097-02 100 µL

DARS Antibody

Sign In for Pricing
View Details
DARS Antibody
KC-17097-03 1 mL

DARS Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS804167 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
2,4-Dinitrofluorobenzene
TRC-D479795-50G 50 g

2,4-Dinitrofluorobenzene

Sign In for Pricing
View Details
LDL Receptor (LDLR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]
TA812507BM 100 µL

LDL Receptor (LDLR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]

Sign In for Pricing
View Details