Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA5 Peptide - N-terminal region

MAGEA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAGE5, MAGEA4, MGC129526, CT1.5

UniProt

P43359

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA5 Rabbit Polyclonal Antibody (orb579740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066387

Preservative

Lyophilized powder

AA Sequence

MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5DC1 (NM_152729) Human Over-expression Lysate
LY403486 100 µg

NT5DC1 (NM_152729) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant JunB Monoclonal Antibody
AN301571L-01 50 µL

Recombinant JunB Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant JunB Monoclonal Antibody
AN301571L-02 100 µL

Recombinant JunB Monoclonal Antibody

Sign In for Pricing
View Details
Arr3 Mouse Gene Knockout Kit (CRISPR)
KN501615 1 Kit

Arr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Elastin (ELN) ELISA Kit
RD-ELN-Mu-01 96 Tests

Mouse Elastin (ELN) ELISA Kit

Sign In for Pricing
View Details
Mouse Elastin (ELN) ELISA Kit
RD-ELN-Mu-02 48 Tests

Mouse Elastin (ELN) ELISA Kit

Sign In for Pricing
View Details