Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEB4 Peptide - N-terminal region

MAGEB4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC33144, CT3.6

UniProt

O15481

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEB4 Rabbit Polyclonal Antibody (orb583115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002358

Preservative

Lyophilized powder

AA Sequence

KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory Receptor 14C36 (OR14C36) Antibody
abx027589-01 80 µL

Olfactory Receptor 14C36 (OR14C36) Antibody

Sign In for Pricing
View Details
Olfactory Receptor 14C36 (OR14C36) Antibody
abx027589-02 400 µL

Olfactory Receptor 14C36 (OR14C36) Antibody

Sign In for Pricing
View Details
Rmnd5a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4493804 1.0 µg DNA

Rmnd5a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
KNTC2 Antibody
E19-3011-1-2 50 µg - 50 µL

KNTC2 Antibody

Sign In for Pricing
View Details
Human Transgelin 2 (TAGLN2) ELISA Kit
orb777187-01 48 Tests

Human Transgelin 2 (TAGLN2) ELISA Kit

Sign In for Pricing
View Details
Human Transgelin 2 (TAGLN2) ELISA Kit
orb777187-02 96 Tests

Human Transgelin 2 (TAGLN2) ELISA Kit

Sign In for Pricing
View Details