MAGEB4 Peptide - N-terminal region
MAGEB4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC33144, CT3.6
UniProt
O15481
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAGEB4 Rabbit Polyclonal Antibody (orb583115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002358
Preservative
Lyophilized powder
AA Sequence
KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP1-88255-25ul 25 µL
Rabbit Polyclonal ICBP90 Binding Protein 1 Antibody
Sign In for Pricing
View Details 
C2548-39K 120 Tests
CD137 (4-1BB, TNFRSF9, 4-1BB ligand receptor, CD137, CD137 antigen, CDw137, ILA, MGC2172, T-cell antigen 4-1BB homolog, T-cell antigen ILA, Tumor necrosis factor receptor superfamily member 9 precursor) (FITC)
Sign In for Pricing
View Details