Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEC2 Peptide - N-terminal region

MAGEC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT10, HCA587, MAGEE1, MGC13377

UniProt

Q9UBF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEC2 Rabbit Polyclonal Antibody (orb584498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057333

Preservative

Lyophilized powder

AA Sequence

SCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-5189-3p Primers
MPH03156 150 µL / 10 µM

hsa-miR-5189-3p Primers

Sign In for Pricing
View Details
CPT1A Rabbit pAb, APC-Cy7 conjugated
orb2460275 100 µL

CPT1A Rabbit pAb, APC-Cy7 conjugated

Sign In for Pricing
View Details
Mouse Adamts6 Pre-designed siRNA Set A
SI100261A 1 Each

Mouse Adamts6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Pyruvate Dehydrogenase Kinase Isozyme 1 (PDK1) ELISA Kit
orb866907-01 48 Tests

Human Pyruvate Dehydrogenase Kinase Isozyme 1 (PDK1) ELISA Kit

Sign In for Pricing
View Details
Human Pyruvate Dehydrogenase Kinase Isozyme 1 (PDK1) ELISA Kit
orb866907-02 96 Tests

Human Pyruvate Dehydrogenase Kinase Isozyme 1 (PDK1) ELISA Kit

Sign In for Pricing
View Details
RMI1 3'UTR Luciferase Stable Cell Line
TU019953 1.0 mL

RMI1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details