Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGED2 Peptide - N-terminal region

MAGED2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386

UniProt

Q9UNF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGED2 Rabbit Polyclonal Antibody (orb584497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_803182

Preservative

Lyophilized powder

AA Sequence

TCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIP120B (CAND2) (NM_001162499) Human Recombinant Protein
TP328656L 1 mg

TIP120B (CAND2) (NM_001162499) Human Recombinant Protein

Sign In for Pricing
View Details
RPS6 (C-term) Rabbit Polyclonal Antibody
AP31752PU-N 50 µL

RPS6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]
CF810111 100 µg

ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]

Sign In for Pricing
View Details
NRAS (NM_002524) Human Over-expression Lysate
LC400901 20 µg

NRAS (NM_002524) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Renal pelvis
CS500133 5x 5 µm

Frozen Tissue Sections, Renal pelvis

Sign In for Pricing
View Details
CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: DF1524]
AM39012RP-N 100 Tests

CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: DF1524]

Sign In for Pricing
View Details