Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Magee1 Peptide - C-terminal region

Magee1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI847422, DAMAGE, mMage-e1

UniProt

Q6PCZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Magee1 Rabbit Polyclonal Antibody (orb583581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444431

Preservative

Lyophilized powder

AA Sequence

GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin N (Cadherin 2, Neuronal, CDH2) (APC)
C0108-35M-APC 100 µL

Cadherin N (Cadherin 2, Neuronal, CDH2) (APC)

Sign In for Pricing
View Details
SRRM3 Polyclonal Antibody
MBS9238431-01 0.1 mL

SRRM3 Polyclonal Antibody

Sign In for Pricing
View Details
SRRM3 Polyclonal Antibody
MBS9238431-02 5x 0.1 mL

SRRM3 Polyclonal Antibody

Sign In for Pricing
View Details
MEIG1 Human shRNA Plasmid Kit (Locus ID 644890)
TL320939 1 Kit

MEIG1 Human shRNA Plasmid Kit (Locus ID 644890)

Sign In for Pricing
View Details
Rabbit Polyclonal MST4 Antibody [Alexa Fluor 647]
NB100-1583AF647 0.1 mL

Rabbit Polyclonal MST4 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Polyclonal Glucocorticoid Receptor alpha Antibody
NB300-633-25ug 25 µg

Rabbit Polyclonal Glucocorticoid Receptor alpha Antibody

Sign In for Pricing
View Details