Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Magee1 Peptide - C-terminal region

Magee1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI847422, DAMAGE, mMage-e1

UniProt

Q6PCZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Magee1 Rabbit Polyclonal Antibody (orb583581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444431

Preservative

Lyophilized powder

AA Sequence

GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ING1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1087707 1.0 µg DNA

ING1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)
MBS1148210-01 0.02 mg (E-Coli)

Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)
MBS1148210-02 0.1 mg (E-Coli)

Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)
MBS1148210-03 0.02 mg (Yeast)

Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)
MBS1148210-04 0.1 mg (Yeast)

Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)
MBS1148210-05 0.02 mg (Baculovirus)

Recombinant Synechocystis sp. Uncharacterized protein sll1783 (sll1783)

Sign In for Pricing
View Details