MAGOHB Peptide - C-terminal region
MAGOHB Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ10292, MGN2, mago, magoh
UniProt
Q96A72
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAGOHB Rabbit Polyclonal Antibody (orb585392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060518
Preservative
Lyophilized powder
AA Sequence
LWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC427093 20 µg
C3orf55 (PQLC2L) (NM_001130002) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC682473-500 1x 500 µL
CD3e (T-Cell Marker) (UCHT1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400097-100 1x 100 µL
Nuclear Membrane (NM97), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details