Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Man2a2 Peptide - N-terminal region

Man2a2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700052O22Rik, 4931438M07Rik, AI480988, MX, Man IIx

UniProt

Q8BRK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Man2a2 Rabbit Polyclonal Antibody (orb579844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766491

Preservative

Lyophilized powder

AA Sequence

PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human R3HCC1L shRNA (UAS) - Lentiviral human R3HCC1L shRNA (UAS) (25)
GTR15142949 1 Vial

Lentiviral human R3HCC1L shRNA (UAS) - Lentiviral human R3HCC1L shRNA (UAS) (25)

Sign In for Pricing
View Details
Acetyl-CoA Acetyltransferase, Mitochondrial, Recombinant, Human, aa34-427
583472-01 20 µg

Acetyl-CoA Acetyltransferase, Mitochondrial, Recombinant, Human, aa34-427

Sign In for Pricing
View Details
Acetyl-CoA Acetyltransferase, Mitochondrial, Recombinant, Human, aa34-427
583472-02 100 µg

Acetyl-CoA Acetyltransferase, Mitochondrial, Recombinant, Human, aa34-427

Sign In for Pricing
View Details
HLA-C shRNA (h) Lentiviral Particles
sc-105525-V 200 µL

HLA-C shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Human REPS2 Pre-designed siRNA Set B
SI013615B 1 Each

Human REPS2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Monoclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)
TRV-0034724-01 20 µL

Monoclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)

Sign In for Pricing
View Details