Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Man2a2 Peptide - N-terminal region

Man2a2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700052O22Rik, 4931438M07Rik, AI480988, MX, Man IIx

UniProt

Q8BRK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Man2a2 Rabbit Polyclonal Antibody (orb579844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766491

Preservative

Lyophilized powder

AA Sequence

PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CABP5 CRISPR Knock Out 293T Cell Line (Human)
14865141 1x 10^6 Cells / 1.0 mL

CABP5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (Biotin)
MBS6144199-01 0.1 mL

S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (Biotin)

Sign In for Pricing
View Details
S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (Biotin)
MBS6144199-02 5x 0.1 mL

S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (Biotin)

Sign In for Pricing
View Details
GENLISA™ Nerve Growth Factor IB (NGFIB) ELISA
KLR4169 1x 96 Well

GENLISA™ Nerve Growth Factor IB (NGFIB) ELISA

Sign In for Pricing
View Details
Fatty Acid Synthetase Activity Assay Kit
AK0289-25T-24S 25 Tests - 24 Samples

Fatty Acid Synthetase Activity Assay Kit

Sign In for Pricing
View Details
Mouse PPME1 shRNA Plasmid
abx977811-01 150 µg

Mouse PPME1 shRNA Plasmid

Sign In for Pricing
View Details