Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MANF Peptide - C-terminal region

MANF Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARMET, ARP, MGC142148, MGC142150

UniProt

A8K878

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MANF Rabbit Polyclonal Antibody (orb584394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006001

Preservative

Lyophilized powder

AA Sequence

EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPRT Mouse Monoclonal Antibody [Clone ID: 1F8D11]
AM06114SU-N 100 µL

HPRT Mouse Monoclonal Antibody [Clone ID: 1F8D11]

Sign In for Pricing
View Details
HLA-DRB1 Polyclonal Antibody
E-AB-18811-01 20 µL

HLA-DRB1 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB1 Polyclonal Antibody
E-AB-18811-02 60 µL

HLA-DRB1 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB1 Polyclonal Antibody
E-AB-18811-03 120 µL

HLA-DRB1 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB1 Polyclonal Antibody
E-AB-18811-04 200 µL

HLA-DRB1 Polyclonal Antibody

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details