Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1 Peptide - C-terminal region

MAPK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk

UniProt

P28482

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK1 Rabbit Polyclonal Antibody (orb584155) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620407

Preservative

Lyophilized powder

AA Sequence

PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]
CL110F 100 µg

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]

Sign In for Pricing
View Details
ISLR Human Gene Knockout Kit (CRISPR)
KN205281 1 Kit

ISLR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HIP1 Antibody
KC-1615-01 50 μL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-1615-02 100 µL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-1615-03 1 mL

HIP1 Antibody

Sign In for Pricing
View Details
HIF1AN Rabbit Polyclonal Antibody
TA367055 100 µL

HIF1AN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details