Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1 Peptide - middle region

MAPK1 Peptide - middle region

Product Specifications

Product Name Alternative

ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk

UniProt

P28482

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK1 Rabbit Polyclonal Antibody (orb584156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620407

Preservative

Lyophilized powder

AA Sequence

RDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc29a1 ORF Vector (Mouse) (pORF)
44084015 1.0 µg DNA

Slc29a1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Glmp Pre-designed siRNA Set A
SI205631A 1 Each

Rat Glmp Pre-designed siRNA Set A

Sign In for Pricing
View Details
ARHG7 Polyclonal Antibody, RBITC Conjugated
bs-2936R-RBITC 100 µL

ARHG7 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ETS1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-1285R-PE-Cy5 100 µL

ETS1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Levo Mepromazine-d3
HY-W744226 1 Each

Levo Mepromazine-d3

Sign In for Pricing
View Details
CaSR shRNA (r) Lentiviral Particles
sc-270329-V 200 µL

CaSR shRNA (r) Lentiviral Particles

Sign In for Pricing
View Details