MAPK1 Peptide - middle region
MAPK1 Peptide - middle region
Product Specifications
Product Name Alternative
ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk
UniProt
P28482
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAPK1 Rabbit Polyclonal Antibody (orb584156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_620407
Preservative
Lyophilized powder
AA Sequence
RDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8803913-01 48 Strip Well
Mouse Ab1-42 (Amyloid Beta Peptide 1-42) ELISA Kit
Sign In for Pricing
View Details MBS8803913-02 96 Strip Well
Mouse Ab1-42 (Amyloid Beta Peptide 1-42) ELISA Kit
Sign In for Pricing
View Details 
MBS8803913-03 5x 96 Strip Well
Mouse Ab1-42 (Amyloid Beta Peptide 1-42) ELISA Kit
Sign In for Pricing
View Details MBS8803913-04 10x 96 Strip Well
Mouse Ab1-42 (Amyloid Beta Peptide 1-42) ELISA Kit
Sign In for Pricing
View Details