Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk10 Peptide - N-terminal region

Mapk10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Jnk3, SAPb, SAPKC, Serk2

UniProt

B0VXR6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mapk10 Rabbit Polyclonal Antibody (orb583686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036938

Preservative

Lyophilized powder

AA Sequence

RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Fluoro-3-nitroaniline
TRC-F621950-5G 5 g

4-Fluoro-3-nitroaniline

Sign In for Pricing
View Details
PCNA (PC10), CF740 conjugate, 0.1mg/mL
BNC740467-100 1x 100 µL

PCNA (PC10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMTC1 (NM_175861) Human Over-expression Lysate
LC403582 20 µg

TMTC1 (NM_175861) Human Over-expression Lysate

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL
BNC881960-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Accuris Taq Polymerase, 1000 units
PR1000-1000 1 Each

Accuris Taq Polymerase, 1000 units

Sign In for Pricing
View Details