Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk10 Peptide - N-terminal region

Mapk10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Jnk3, SAPb, SAPKC, Serk2

UniProt

B0VXR6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mapk10 Rabbit Polyclonal Antibody (orb583686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036938

Preservative

Lyophilized powder

AA Sequence

RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microparticle Stabilizer Solution
C1010002 50 mL

Microparticle Stabilizer Solution

Sign In for Pricing
View Details
Polystyrene A FP
HA140007.100G 100 g

Polystyrene A FP

Sign In for Pricing
View Details
ARSI (NM_001012301) Human Over-expression Lysate
LY423321 100 µg

ARSI (NM_001012301) Human Over-expression Lysate

Sign In for Pricing
View Details
FZD5/FZD8 Rabbit Polyclonal Antibody
AP01257PU-N 100 µg

FZD5/FZD8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TCTN1 activation kit by CRISPRa
GA112481 1 Kit

Human TCTN1 activation kit by CRISPRa

Sign In for Pricing
View Details
Monochloro-BPF
TRC-M948530-50MG 50 mg

Monochloro-BPF

Sign In for Pricing
View Details