Mapk12 Peptide - C-terminal region
Mapk12 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AW123708, Erk6, P38gamma, Prkm12, Sapk3
UniProt
O08911
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mapk12 Rabbit Polyclonal Antibody (orb583206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038899
Preservative
Lyophilized powder
AA Sequence
ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8420792 Inquire
Mouse PAI-1 Genetically Deficient Spleen Lyophilized
Sign In for Pricing
View Details UJD58326-01 5 mg
N-[3- (1H-Imidazol-1-yl) -5- (trifluoromethyl) phenyl]-4-methyl-3-[[4- (3-pyridinyl) -2-pyrimidinyl]amino]benzamide
Sign In for Pricing
View Details UJD58326-02 10 mg
N-[3- (1H-Imidazol-1-yl) -5- (trifluoromethyl) phenyl]-4-methyl-3-[[4- (3-pyridinyl) -2-pyrimidinyl]amino]benzamide
Sign In for Pricing
View Details UJD58326-03 25 mg
N-[3- (1H-Imidazol-1-yl) -5- (trifluoromethyl) phenyl]-4-methyl-3-[[4- (3-pyridinyl) -2-pyrimidinyl]amino]benzamide
Sign In for Pricing
View Details