Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK6 Peptide - middle region

MAPK6 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686F03189, ERK3, HsT17250, PRKM6, p97MAPK

UniProt

Q16659

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK6 Rabbit Polyclonal Antibody (orb583158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002739

Preservative

Lyophilized powder

AA Sequence

QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGCGL2 ORF Vector (Human) (pORF)
49098012 1.0 µg DNA

UGCGL2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-Andes Virus (Hantavirus) (Clone: ANDV-44)
12-8121-100 100 µg

Anti-Andes Virus (Hantavirus) (Clone: ANDV-44)

Sign In for Pricing
View Details
Gdap1 (NM_001107897) Rat Tagged ORF Clone Lentiviral Particle
RR214249L3V 200 µL

Gdap1 (NM_001107897) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-NOCT antibody
STJ118264 100 µl

Anti-NOCT antibody

Sign In for Pricing
View Details
Rabbit Anti-NT5C1B/RDH14 antibody
SL19487R-01 50 µL

Rabbit Anti-NT5C1B/RDH14 antibody

Sign In for Pricing
View Details
Rabbit Anti-NT5C1B/RDH14 antibody
SL19487R-02 100 µL

Rabbit Anti-NT5C1B/RDH14 antibody

Sign In for Pricing
View Details