MAPK6 Peptide - middle region
MAPK6 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp686F03189, ERK3, HsT17250, PRKM6, p97MAPK
UniProt
Q16659
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAPK6 Rabbit Polyclonal Antibody (orb583158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002739
Preservative
Lyophilized powder
AA Sequence
QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15370780 1 Vial
Lentiviral human CASKIN1 sgRNA gene knockout kit - Lentiviral human CASKIN1 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
GTR15229827 1 Vial
Lentiviral mouse Bicc1 shRNA (UAS) - Lentiviral mouse Bicc1 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
25228061 1.0 µg DNA
JAK3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details