Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk9 Peptide - N-terminal region

Mapk9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI851083, JNK2, Prkm9, p54aSAPK

UniProt

Q9WTU6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mapk9 Rabbit Polyclonal Antibody (orb330942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058657

Preservative

Lyophilized powder

AA Sequence

VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCD1 Recombinant Mouse Monoclonal Antibody [A9A11-R]
HA601180 100 µL

SCD1 Recombinant Mouse Monoclonal Antibody [A9A11-R]

Sign In for Pricing
View Details
TNG-462
E1871-25mg 25 mg

TNG-462

Sign In for Pricing
View Details
Bivamelagon hydrochloride
T79091-01 1 mg

Bivamelagon hydrochloride

Sign In for Pricing
View Details
Bivamelagon hydrochloride
T79091-02 5 mg

Bivamelagon hydrochloride

Sign In for Pricing
View Details
Bivamelagon hydrochloride
T79091-03 10 mg

Bivamelagon hydrochloride

Sign In for Pricing
View Details
Bivamelagon hydrochloride
T79091-04 25 mg

Bivamelagon hydrochloride

Sign In for Pricing
View Details