Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk9 Peptide - N-terminal region

Mapk9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI851083, JNK2, Prkm9, p54aSAPK

UniProt

Q9WTU6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mapk9 Rabbit Polyclonal Antibody (orb330942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058657

Preservative

Lyophilized powder

AA Sequence

VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epi Dienogest
448288-01 1 mg

Epi Dienogest

Sign In for Pricing
View Details
Epi Dienogest
448288-02 2.5 mg

Epi Dienogest

Sign In for Pricing
View Details
Hist1h2bf sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3103704 1.0 µg DNA

Hist1h2bf sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Human STC2 protein, His-tagged
STC2-3028H 25 µg

Recombinant Human STC2 protein, His-tagged

Sign In for Pricing
View Details
Hgs (NM_008244) Mouse Tagged ORF Clone Lentiviral Particle
MR227581L4V 200 µL

Hgs (NM_008244) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Numbl AAV siRNA Pooled Vector
32314166 1.0 µg

Numbl AAV siRNA Pooled Vector

Sign In for Pricing
View Details