Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK2 Peptide - middle region

MAPKAPK2 Peptide - middle region

Product Specifications

Product Name Alternative

3PK, MAPKAP3, MK2, MK-2, MAPKAP-K2

UniProt

Q16644

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK2 Rabbit Polyclonal Antibody (orb331093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004626

Preservative

Lyophilized powder

AA Sequence

KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREG1 Knockout Raji Polyclonal Cells
ARG1396 1 Million

CREG1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Msn-set siRNA/shRNA/RNAi Lentivector (Mouse)
30753094 4x 500 ng

Msn-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
(R) -2- ((1- (7- (but-2-yn-1-yl) -3-methyl-1- ((4-methylquinazolin-2-yl) methyl) -2,6-dioxo-2,3,6,7-tetrahydro-1H-purin-8-yl) piperidin-3-yl) carbamoyl) benzoic acid
OR1075566 5 mg

(R) -2- ((1- (7- (but-2-yn-1-yl) -3-methyl-1- ((4-methylquinazolin-2-yl) methyl) -2,6-dioxo-2,3,6,7-tetrahydro-1H-purin-8-yl) piperidin-3-yl) carbamoyl) benzoic acid

Sign In for Pricing
View Details
Brilliant Violet 570™ Mouse IgG1, κ Isotype Ctrl
GT16954 100 Tests

Brilliant Violet 570™ Mouse IgG1, κ Isotype Ctrl

Sign In for Pricing
View Details
Artificial Sweat or Perspiration, ISO 11641 Sweat – Custom pH, Not Stabilized (BZ145) - 1000mL
BZ145-01 100 mL

Artificial Sweat or Perspiration, ISO 11641 Sweat – Custom pH, Not Stabilized (BZ145) - 1000mL

Sign In for Pricing
View Details
Artificial Sweat or Perspiration, ISO 11641 Sweat – Custom pH, Not Stabilized (BZ145) - 1000mL
BZ145-02 200 mL

Artificial Sweat or Perspiration, ISO 11641 Sweat – Custom pH, Not Stabilized (BZ145) - 1000mL

Sign In for Pricing
View Details