Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK2 Peptide - middle region

MAPKAPK2 Peptide - middle region

Product Specifications

Product Name Alternative

3PK, MAPKAP3, MK2, MK-2, MAPKAP-K2

UniProt

Q16644

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK2 Rabbit Polyclonal Antibody (orb331093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004626

Preservative

Lyophilized powder

AA Sequence

KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1282705-01 0.05 mg (E-Coli)

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details
Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1282705-02 0.05 mg (Yeast)

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details
Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1282705-03 0.2 mg (E-Coli)

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details
Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1282705-04 0.5 mg (E-Coli)

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details
Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1282705-05 0.05 mg (Baculovirus)

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details
Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1282705-06 0.2 mg (Yeast)

Recombinant Psathyrotes annua NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details