Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK3 Peptide - C-terminal region

MAPKAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3PK, MAPKAP3, MK-3, MAPKAP-K3, MAPKAPK-3

UniProt

Q16644

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK3 Rabbit Polyclonal Antibody (orb584639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004626

Preservative

Lyophilized powder

AA Sequence

PLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCSH (Glucosidase 2 subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain, PCLD, PLD1, G19P1, PKCSH, AGE-R2) (FITC)
MBS6433044-01 0.1 mL

PRKCSH (Glucosidase 2 subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain, PCLD, PLD1, G19P1, PKCSH, AGE-R2) (FITC)

Sign In for Pricing
View Details
PRKCSH (Glucosidase 2 subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain, PCLD, PLD1, G19P1, PKCSH, AGE-R2) (FITC)
MBS6433044-02 5x 0.1 mL

PRKCSH (Glucosidase 2 subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain, PCLD, PLD1, G19P1, PKCSH, AGE-R2) (FITC)

Sign In for Pricing
View Details
7-[4- (Trifluoromethyl) Coumarin]Acrylamide
PC108470-01 100 mg

7-[4- (Trifluoromethyl) Coumarin]Acrylamide

Sign In for Pricing
View Details
7-[4- (Trifluoromethyl) Coumarin]Acrylamide
PC108470-02 250 mg

7-[4- (Trifluoromethyl) Coumarin]Acrylamide

Sign In for Pricing
View Details
7-[4- (Trifluoromethyl) Coumarin]Acrylamide
PC108470-03 1 g

7-[4- (Trifluoromethyl) Coumarin]Acrylamide

Sign In for Pricing
View Details
TremL4 (NM_172623) Mouse Untagged Clone
MC212740 10 µg

TremL4 (NM_172623) Mouse Untagged Clone

Sign In for Pricing
View Details