March2 Peptide - middle region
March2 Peptide - middle region
Product Specifications
Product Name Alternative
9530046H09Rik, MGC7259, MARCH-II
UniProt
Q8CA25
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_663461
Preservative
Lyophilized powder
AA Sequence
LAAISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1220785-01 0.02 mg (E-Coli)
Recombinant Thermoanaerobacter sp. UPF0122 protein Teth514_1714 (Teth514_1714)
Sign In for Pricing
View Details MBS1220785-02 0.1 mg (E-Coli)
Recombinant Thermoanaerobacter sp. UPF0122 protein Teth514_1714 (Teth514_1714)
Sign In for Pricing
View Details MBS1220785-03 0.02 mg (Yeast)
Recombinant Thermoanaerobacter sp. UPF0122 protein Teth514_1714 (Teth514_1714)
Sign In for Pricing
View Details MBS1220785-04 0.1 mg (Yeast)
Recombinant Thermoanaerobacter sp. UPF0122 protein Teth514_1714 (Teth514_1714)
Sign In for Pricing
View Details