Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

March2 Peptide - middle region

March2 Peptide - middle region

Product Specifications

Product Name Alternative

9530046H09Rik, MGC7259, MARCH-II

UniProt

Q8CA25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663461

Preservative

Lyophilized powder

AA Sequence

LAAISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPY17P 3'UTR Luciferase Stable Cell Line
TU027350 1.0 mL

TSPY17P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester
292693-01 1 g

1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester

Sign In for Pricing
View Details
1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester
292693-02 2 g

1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester

Sign In for Pricing
View Details
1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester
292693-03 5 g

1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester

Sign In for Pricing
View Details
1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester
292693-04 10 g

1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester

Sign In for Pricing
View Details
1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester
292693-05 25 g

1-Bromo-2,3,4-tri-O-acetyl-a-D-glucuronide methyl ester

Sign In for Pricing
View Details