Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

March3 Peptide - C-terminal region

March3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6330411I15Rik, A530081L18Rik, AI843639, MARCH-III, MGC130167, MGC130168

UniProt

Q8BRX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARCH3 Rabbit Polyclonal Antibody (orb55681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_796089

Preservative

Lyophilized powder

AA Sequence

PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XTP3TPA (DCTPP1) Human Gene Knockout Kit (CRISPR)
KN401727 1 Kit

XTP3TPA (DCTPP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FADS2 (N-term) Rabbit Polyclonal Antibody
AP51507PU-N 200 µL

FADS2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pure Erythrina cristagalli Lectin (Coral Tree) -ECA-
L-5901-1 1 mg

Pure Erythrina cristagalli Lectin (Coral Tree) -ECA-

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF647 conjugate, 0.1mg/mL
BNC472042-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat OC/BGP Antibody Pair Set
E-KAB-0627 50 µL & 100 µg

Rat OC/BGP Antibody Pair Set

Sign In for Pricing
View Details
(2E,4E)-2,4-Dodecadienoic Acid
TRC-D358950-500MG 500 mg

(2E,4E)-2,4-Dodecadienoic Acid

Sign In for Pricing
View Details