Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

March3 Peptide - C-terminal region

March3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6330411I15Rik, A530081L18Rik, AI843639, MARCH-III, MGC130167, MGC130168

UniProt

Q8BRX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARCH3 Rabbit Polyclonal Antibody (orb55681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_796089

Preservative

Lyophilized powder

AA Sequence

PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPUL1 (HNRNPUL1) Human Gene Knockout Kit (CRISPR)
KN400576 1 Kit

HNRPUL1 (HNRNPUL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Cecum
CB536227 1 Block

Frozen Tissue Blocks, Cecum

Sign In for Pricing
View Details
Biotin Conjugated Goat Affinity Purified Antibody to Equine IgG,
BAF-431-1 1 mL

Biotin Conjugated Goat Affinity Purified Antibody to Equine IgG,

Sign In for Pricing
View Details
Vmn1r78 Mouse Gene Knockout Kit (CRISPR)
KN519094 1 Kit

Vmn1r78 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABH2 (ALKBH2) (NM_001145375) Human Over-expression Lysate
LC428854 20 µg

ABH2 (ALKBH2) (NM_001145375) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Boc-4-(6-aminopyridin-3-yl)piperazine-d4
TRC-B621162-25MG 25 mg

1-Boc-4-(6-aminopyridin-3-yl)piperazine-d4

Sign In for Pricing
View Details