Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MASTL Peptide - C-terminal region

MASTL Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14813, RP11-85G18.2, THC2, GW, GWL, hGWL, MAST-L, GREATWALL

UniProt

Q96GX5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116233

Preservative

Lyophilized powder

AA Sequence

NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HIF-1 alpha/HIF1A Antibody Picoband® (Biotine Conjugate)
A00013-1-Biotin 100 µg/Vial

Anti-HIF-1 alpha/HIF1A Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
6-bromo-2- (3-isopropoxyphenyl) quinoline-4-carbonyl chloride
sc-337072 100 mg

6-bromo-2- (3-isopropoxyphenyl) quinoline-4-carbonyl chloride

Sign In for Pricing
View Details
Ntn5 ORF Vector (Rat) (pORF)
ORF071565 1.0 µg DNA

Ntn5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal MST1/STK4 Antibody (07) [FITC]
NBP3-06389F 0.1 mL

Mouse Monoclonal MST1/STK4 Antibody (07) [FITC]

Sign In for Pricing
View Details
Recombinant Human CD32b / FCGR2B Protein (His tag)
E53A08246 50 µg

Recombinant Human CD32b / FCGR2B Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IkB-alpha Protein
NBP1-72500-50ug 50 µg

Recombinant Human IkB-alpha Protein

Sign In for Pricing
View Details