Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mbd3 Peptide - N-terminal region

Mbd3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI181826, AU019209

UniProt

Q9Z2D8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mbd3 Rabbit Polyclonal Antibody (orb577461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038623

Preservative

Lyophilized powder

AA Sequence

MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit
RD-MGA-Hu-01 96 Tests

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit

Sign In for Pricing
View Details
Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit
RD-MGA-Hu-02 48 Tests

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812J-01 20 Tests

PerCP/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812J-02 100 Tests

PerCP/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812J-03 2x 100 Tests

PerCP/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
CLPP Antibody
KC-16864-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details