Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mbd3 Peptide - N-terminal region

Mbd3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI181826, AU019209

UniProt

Q9Z2D8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mbd3 Rabbit Polyclonal Antibody (orb577461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038623

Preservative

Lyophilized powder

AA Sequence

MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC41A3 Human Gene Knockout Kit (CRISPR)
KN402286 1 Kit

SLC41A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UC-01 25 µg

FITC Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
FITC Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UC-02 100 µg

FITC Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823Q-01 25 µg

Elab Fluor® Violet 450 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823Q-02 100 µg

Elab Fluor® Violet 450 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
SMARCA2 Human Gene Knockout Kit (CRISPR)
KN415950 1 Kit

SMARCA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details